Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 9 (Olfr9)

This Recombinant Mouse Olfactory receptor 9 (Olfr9) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 9, Odorant receptor M25, Olfactory receptor 269-3

UniProt

Q60885

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDDNDTDITEFILLGFSGYGFLQGHLFWGVLCIYVVTLLGNSLIVLLTLADSALHSPMY FFLRHFSVVEILYTTTIVPRMLADLRSSCPTIPLASCFTQLYFFALFGIAECCLLTAMAY DRYAAICCPLHYTTLMSQGTYTGLVGASYLAGVISGTTHSIFIFTLPFRGAKTIHHFLCD ILPVLRLATASTFWGEVGNLFVTITFIFVPFLLIVASYACILVTILGVATSQGRQKLFST CSSHLFVVILFFGTATVAYMRPQADSFGNTDQILTLVYTVVTPMCNPFVYSLRNKEVTGA MRRLMKRYLWGP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BSND Antibody
E311113 200 µL

BSND Antibody

Sign In for Pricing
View Details
RFX3 Protein Vector (Rat) (pPB-N-His)
PV298923 500 ng

RFX3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Human TROP-2
Pr22457-01 10 µg

Recombinant Human TROP-2

Sign In for Pricing
View Details
Recombinant Human TROP-2
Pr22457-02 50 µg

Recombinant Human TROP-2

Sign In for Pricing
View Details
Recombinant Human TROP-2
Pr22457-03 500 µg

Recombinant Human TROP-2

Sign In for Pricing
View Details
Recombinant Human TROP-2
Pr22457-04 1 mg

Recombinant Human TROP-2

Sign In for Pricing
View Details