Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 9 (Olfr9)

This Recombinant Mouse Olfactory receptor 9 (Olfr9) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 9, Odorant receptor M25, Olfactory receptor 269-3

UniProt

Q60885

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDDNDTDITEFILLGFSGYGFLQGHLFWGVLCIYVVTLLGNSLIVLLTLADSALHSPMY FFLRHFSVVEILYTTTIVPRMLADLRSSCPTIPLASCFTQLYFFALFGIAECCLLTAMAY DRYAAICCPLHYTTLMSQGTYTGLVGASYLAGVISGTTHSIFIFTLPFRGAKTIHHFLCD ILPVLRLATASTFWGEVGNLFVTITFIFVPFLLIVASYACILVTILGVATSQGRQKLFST CSSHLFVVILFFGTATVAYMRPQADSFGNTDQILTLVYTVVTPMCNPFVYSLRNKEVTGA MRRLMKRYLWGP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC1A6 siRNA (Rat)
MBS8203100-01 15 nmol

SLC1A6 siRNA (Rat)

Sign In for Pricing
View Details
SLC1A6 siRNA (Rat)
MBS8203100-02 30 nmol

SLC1A6 siRNA (Rat)

Sign In for Pricing
View Details
SLC1A6 siRNA (Rat)
MBS8203100-03 5x 30 nmol

SLC1A6 siRNA (Rat)

Sign In for Pricing
View Details
Krt42 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3044005 3x 1.0 µg

Krt42 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
BAAT Rabbit pAb
E45R27573N-50 50 µL

BAAT Rabbit pAb

Sign In for Pricing
View Details
Ataxin 3 Rabbit Polyclonal Antibody (BF405)
orb2492141 100 µL

Ataxin 3 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details