Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 9 (Olfr9)

This Recombinant Mouse Olfactory receptor 9 (Olfr9) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 9, Odorant receptor M25, Olfactory receptor 269-3

UniProt

Q60885

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDDNDTDITEFILLGFSGYGFLQGHLFWGVLCIYVVTLLGNSLIVLLTLADSALHSPMY FFLRHFSVVEILYTTTIVPRMLADLRSSCPTIPLASCFTQLYFFALFGIAECCLLTAMAY DRYAAICCPLHYTTLMSQGTYTGLVGASYLAGVISGTTHSIFIFTLPFRGAKTIHHFLCD ILPVLRLATASTFWGEVGNLFVTITFIFVPFLLIVASYACILVTILGVATSQGRQKLFST CSSHLFVVILFFGTATVAYMRPQADSFGNTDQILTLVYTVVTPMCNPFVYSLRNKEVTGA MRRLMKRYLWGP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/iFluor® 647 Anti-human CD206 Antibody *15-2*
120601P0-AAT 25 Tests

PE/iFluor® 647 Anti-human CD206 Antibody *15-2*

Sign In for Pricing
View Details
E Cadherin (CDH1) Rabbit Polyclonal Antibody
TA321651 100 µL

E Cadherin (CDH1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Flt-3/Flk-2/CD135 Antibody (MM0294-9G23) [Alexa Fluor 350]
NBP2-12311AF350 0.1 mL

Mouse Monoclonal Flt-3/Flk-2/CD135 Antibody (MM0294-9G23) [Alexa Fluor 350]

Sign In for Pricing
View Details
NFIA Mouse Monoclonal Antibody (FITC)
orb2610112 100 µg

NFIA Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
Rabbit Monoclonal WT1 Antibody (WT1/3477R) [Alexa Fluor 405]
NBP3-08966AF405 100 µL

Rabbit Monoclonal WT1 Antibody (WT1/3477R) [Alexa Fluor 405]

Sign In for Pricing
View Details
APM2 rabbit pAb
MBS8598719-01 0.1 mL

APM2 rabbit pAb

Sign In for Pricing
View Details