Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Taste receptor type 2 member 9 (TAS2R9)

This Recombinant Pongo pygmaeus Taste receptor type 2 member 9 (TAS2R9) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 9, T2R9

UniProt

Q645V9

Expression Region

1-312

Origin

Pongo pygmaeus (Bornean orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSAIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDVSLIDIILISLAISRICLLX VISLDGFFMLLFPTTYGNSVLVSIVBIVWTFANNSSLWFTSCLSIFYLLKIANISHPFFF WLKLKINKVILAILLGSFLISLVISVXMNDDMWYHLFKVSHEENITWEFKVSKIPGTFKQ LTLNLGAMVPFILCLISFSLLLFSLVRHTKQIQLXATGFRDPSTEAHMRAIKAVIIFLLL LIVYYPVFLVMTSSALIPQGKLVLMIGDIVTITFPSSHSFILIMGNSKLREAFLKMLRFV KRFLRRRKPFVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-500 1x 500 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-100 1x 100 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-100 1x 100 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-500 1x 500 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details