Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 5 (Olfr5)

This Recombinant Mouse Olfactory receptor 5 (Olfr5) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 5, Odorant receptor M41, Olfactory receptor 103-8

UniProt

Q60889

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERSLALANMTRVQQFILLGLSTRLDIRDALFAVFLTLYLLTLLENTLIIYLICSHKELH KPMYFFLGNLSCLEMCYVSVTMPTLLMGLWNGLYHIPFIACMTQLFFFIVLVGTECILLA SMAYDRYVAICRPLHYPVLMRPQVCLGLAMISWLGGLLVSMIKTTCIATLSYCGPNVLNH FFCDVSPLLNLSCTHVALTELVDFISAIVILWGCFLTTMASYVAIGRAVLRMPSTTARYK AFSTCASHLVVVGIFYSVTIFIYARPKRIEAMDLNKVLSVIYTVVTPMCNPVIYCLRNKE VQVALHRTMHWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RibP ELISA kit
55R-ORG517 96 wells

RibP ELISA kit

Sign In for Pricing
View Details
IL22RA1 (Interleukin 22 Receptor, alpha 1, CRF2-9, IL22R, IL22R1) (PE)
MBS6183976-01 0.1 mL

IL22RA1 (Interleukin 22 Receptor, alpha 1, CRF2-9, IL22R, IL22R1) (PE)

Sign In for Pricing
View Details
IL22RA1 (Interleukin 22 Receptor, alpha 1, CRF2-9, IL22R, IL22R1) (PE)
MBS6183976-02 5x 0.1 mL

IL22RA1 (Interleukin 22 Receptor, alpha 1, CRF2-9, IL22R, IL22R1) (PE)

Sign In for Pricing
View Details
EXOSC10 (C) Antibody, Rabbit Polyclonal
orb387743 100 µL

EXOSC10 (C) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
MPP3 (D-8) : m-IgGκ BP-HRP Bundle
sc-523356 1 Kit

MPP3 (D-8) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Bile salt activated lipase (CEL) Human qPCR Primer Pair (NM_001807)
HP205594 200 Reactions

Bile salt activated lipase (CEL) Human qPCR Primer Pair (NM_001807)

Sign In for Pricing
View Details