Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 5 (Olfr5)

This Recombinant Mouse Olfactory receptor 5 (Olfr5) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 5, Odorant receptor M41, Olfactory receptor 103-8

UniProt

Q60889

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERSLALANMTRVQQFILLGLSTRLDIRDALFAVFLTLYLLTLLENTLIIYLICSHKELH KPMYFFLGNLSCLEMCYVSVTMPTLLMGLWNGLYHIPFIACMTQLFFFIVLVGTECILLA SMAYDRYVAICRPLHYPVLMRPQVCLGLAMISWLGGLLVSMIKTTCIATLSYCGPNVLNH FFCDVSPLLNLSCTHVALTELVDFISAIVILWGCFLTTMASYVAIGRAVLRMPSTTARYK AFSTCASHLVVVGIFYSVTIFIYARPKRIEAMDLNKVLSVIYTVVTPMCNPVIYCLRNKE VQVALHRTMHWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCS 5861528
256883-01 10 mg

TCS 5861528

Sign In for Pricing
View Details
TCS 5861528
256883-02 50 mg

TCS 5861528

Sign In for Pricing
View Details
Ceacam9 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
15820154 3x 1.0 µg DNA

Ceacam9 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Hsp90 beta Rabbit Monoclonal Antibody, 1 pack = 20 µL
BAL5971 1 Each

Hsp90 beta Rabbit Monoclonal Antibody, 1 pack = 20 µL

Sign In for Pricing
View Details
Mouse Cell division cycle protein 20 homolog B (CDC20B) ELISA kit
GTR10393726 96 Well

Mouse Cell division cycle protein 20 homolog B (CDC20B) ELISA kit

Sign In for Pricing
View Details
MBP Recombinant Rabbit mAb, BF350 conjugated
orb3126525 100 µL

MBP Recombinant Rabbit mAb, BF350 conjugated

Sign In for Pricing
View Details