Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 140 (Tas2r140)

This Recombinant Rat Taste receptor type 2 member 140 (Tas2r140) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 140, T2R140, Taste receptor type 2 member 31, T2R31

UniProt

Q67ES0

Expression Region

1-312

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVTVECALLITLIVEIIIGCLGNGFIAVVNIMDWTKRRRFSLVDQILTALAISRLAFVW SLLTVLVISELHSSLLITRKMLRIINNFWTVTNHFSIWLATCLSIFYFLKIANFSNSIFL SLRWRVKTVVSLTLLVSLLLLLVNVIIINTCIVISVEGYKVNMSYSSHFNNNPQISRIPL FTNTMFTFIPFTVTLTIFLLLIFSLWRHLKKMQHRAKGPRDPSTTAHIKALQMVVTFLFL YTIFFLALVMQAWNNEIQSKTVFNLVFESIALAFPSGHSCVLILGNSKLRQAFLTIIWWL RSSFNAAELSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-100 1x 100 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (K72.7), CF405S conjugate, 0.1mg/mL
BNC040757-100 1x 100 µL

Cytokeratin 7 (K72.7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (B22.1), CF594 conjugate, 0.1mg/mL
BNC941266-100 1x 100 µL

Cytokeratin 8 (KRT8) (B22.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-500 1x 500 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details