Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4F3/4F16/4F29 (OR4F3)

This Recombinant Human Olfactory receptor 4F3/4F16/4F29 (OR4F3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 4F3/4F16/4F29, Olfactory receptor OR1-1

UniProt

Q6IEY1

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMY FLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVVGGVEMVLLIAMAF DRYVALCKPLHYLTIMSPRMCLSFLAVAWTLGVSHSLFQLAFLVNLAFCGPNVLDSFYCD LPRLLRLACTDTYRLQFMVTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALSTL SAHSTVVLLFFGPPMFVYTRPHPNSQMDKFLAIFDAVLTPFLNPVVYTFRNKEMKAAIKR VCKQLVIYKRIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT17 (NM_001012758) Human Over-expression Lysate
LY422833 100 µg

NUDT17 (NM_001012758) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (E484K) (His Tag)
PKSV030366 100 µg

Recombinant SARS-CoV-2 Spike RBD (E484K) (His Tag)

Sign In for Pricing
View Details
FT1A (FUT6) (NM_000150) Human Over-expression Lysate
LC424900 20 µg

FT1A (FUT6) (NM_000150) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ect2 activation kit by CRISPRa
GA201171 1 Kit

Mouse Ect2 activation kit by CRISPRa

Sign In for Pricing
View Details
3,3',5'-Triiodo-L-thyronine O-Beta-D-Glucuronide
TRC-T795425-1MG 1 mg

3,3',5'-Triiodo-L-thyronine O-Beta-D-Glucuronide

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon
CP565846 150 µg

Tissue Protein Lysate, Colon

Sign In for Pricing
View Details