Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4F3/4F16/4F29 (OR4F3)

This Recombinant Human Olfactory receptor 4F3/4F16/4F29 (OR4F3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 4F3/4F16/4F29, Olfactory receptor OR1-1

UniProt

Q6IEY1

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMY FLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVVGGVEMVLLIAMAF DRYVALCKPLHYLTIMSPRMCLSFLAVAWTLGVSHSLFQLAFLVNLAFCGPNVLDSFYCD LPRLLRLACTDTYRLQFMVTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALSTL SAHSTVVLLFFGPPMFVYTRPHPNSQMDKFLAIFDAVLTPFLNPVVYTFRNKEMKAAIKR VCKQLVIYKRIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRTAP27-1 activation kit by CRISPRa
GA118707 1 Kit

Human KRTAP27-1 activation kit by CRISPRa

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF740 conjugate, 0.1mg/mL
BNC741897-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ASZ1 (NM_130768) Human Recombinant Protein
TP319070L 1 mg

ASZ1 (NM_130768) Human Recombinant Protein

Sign In for Pricing
View Details
MARVELD2 (C-term) Rabbit Polyclonal Antibody
AP52590PU-N 400 µL

MARVELD2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calcein AM Cell Viability Assay Kit (1000 assays)
#30026 1 Kit

Calcein AM Cell Viability Assay Kit (1000 assays)

Sign In for Pricing
View Details
FAK (PTK2) Rabbit Polyclonal Antibody
AP21028PU-N 100 µg

FAK (PTK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details