Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6B2 (OR6B2)

This Recombinant Human Olfactory receptor 6B2 (OR6B2) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6B2, Olfactory receptor OR2-1

UniProt

Q6IFH4

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGENVTKVSTFILVGLPTAPGLQYLLFLLFLLTYLFVLVENLAIILIVWSSTSLHRPMY YFLSSMSFLEIWYVSDITPKMLEGFLLQQKRISFVGCMTQLYFFSSLVCTECVLLASMAY DRYVAICHPLRYHVLVTPGLCLQLVGFSFVSGFTISMIKVCFISSVTFCGSNVLNHFFCD ISPILKLACTDFSTAELVDFILAFIILVFPLLATILSYWHITLAVLRIPSATGCWRAFST CASHLTVVTVFYTALLFMYVRPQAIDSQSSNKLISAVYTVVTPIINPLIYCLRNKEFKDA LKKALGLGQTSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit LUM (Lumican) ValidElisa Kit
EK347016 96 Well

Rabbit LUM (Lumican) ValidElisa Kit

Sign In for Pricing
View Details
Human non-neuronal enolase,NNE ELISA Kit
CN-04500H2 48T

Human non-neuronal enolase,NNE ELISA Kit

Sign In for Pricing
View Details
ZNF3 (Zinc Finger Protein 3, Zinc Finger Protein HF.12, Zinc Finger Protein HZF3.1, Zinc Finger Protein KOX25, A8-51, HF.12, KOX25, PP838, Zfp113) (HRP)
MBS6155876-01 0.1 mL

ZNF3 (Zinc Finger Protein 3, Zinc Finger Protein HF.12, Zinc Finger Protein HZF3.1, Zinc Finger Protein KOX25, A8-51, HF.12, KOX25, PP838, Zfp113) (HRP)

Sign In for Pricing
View Details
ZNF3 (Zinc Finger Protein 3, Zinc Finger Protein HF.12, Zinc Finger Protein HZF3.1, Zinc Finger Protein KOX25, A8-51, HF.12, KOX25, PP838, Zfp113) (HRP)
MBS6155876-02 5x 0.1 mL

ZNF3 (Zinc Finger Protein 3, Zinc Finger Protein HF.12, Zinc Finger Protein HZF3.1, Zinc Finger Protein KOX25, A8-51, HF.12, KOX25, PP838, Zfp113) (HRP)

Sign In for Pricing
View Details
[KO Validated] LYAR Rabbit pAb
MBS9144501-01 0.02 mL

[KO Validated] LYAR Rabbit pAb

Sign In for Pricing
View Details
[KO Validated] LYAR Rabbit pAb
MBS9144501-02 0.1 mL

[KO Validated] LYAR Rabbit pAb

Sign In for Pricing
View Details