Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 140 (Tas2r140)

This Recombinant Mouse Taste receptor type 2 member 140 (Tas2r140) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 140, T2R140, T2R13, T2R8, Taste receptor family B member 3, mTRB3, mTRB5, Taste receptor type 2 member 40, Short n

UniProt

Q7TQA4

Expression Region

1-312

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNATVKCTLLIILGVEIIIGCLGNGFIAVVNIMDWAKRRKISLVDQIFTALAISRLAFVW SLLTVLFTSELYSALMTTRKVLIIFNNSWTVINHFNIWLATCLSIFYFLMIANFSNSIFL SLRWRVKTVVSVTLLMSLLLLFVNVLVINTFIVISVDVYKVNTSYSSHSDNNIHISRIFL FTNTIFTFIPFSVTLTIFLLLIFSLWTHLKNMQHNAKDSRDPSTTAHIKALQMMVTFLLL YTIFFLALVMQSSKMKFLSSTVFNYFFEVISLAFPSGHSCVLILGNSKLRQTFISTVWWL KSSFNAAELPGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF640R conjugate, 0.1mg/mL
BNC402363-500 1x 500 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-(Pentyl-d11)-3-(4-ethyl-naphthoyl)indole
TRC-P279902-50MG 50 mg

1-(Pentyl-d11)-3-(4-ethyl-naphthoyl)indole

Sign In for Pricing
View Details
HMGN2P46 Mouse Monoclonal Antibody [Clone ID: OTI4H3]
CF810582 100 µg

HMGN2P46 Mouse Monoclonal Antibody [Clone ID: OTI4H3]

Sign In for Pricing
View Details
BOK (NM_032515) Human Over-expression Lysate
LC403170 20 µg

BOK (NM_032515) Human Over-expression Lysate

Sign In for Pricing
View Details
ENTPD7 Polyclonal Antibody
E-AB-15205-01 20 µL

ENTPD7 Polyclonal Antibody

Sign In for Pricing
View Details
ENTPD7 Polyclonal Antibody
E-AB-15205-02 60 µL

ENTPD7 Polyclonal Antibody

Sign In for Pricing
View Details