Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Chitin synthase export chaperone (CHS7)

This Recombinant Candida glabrata Chitin synthase export chaperone (CHS7) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

Q6FT25

Expression Region

1-312

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGISNFASICSRTPLPLCSVIKSTTHLVLSNSTKIHDFDPQHLNIGILPKCYARSIDIAN TTIFGIGNAFINIAALGVILIILYNIRQKYTAIGRSEYLYFFQLTLLLIIFTLIVNCGVS PPGSNSFPYFVAVQIGLAGACCWTLLINGFLGFNLWEDGTTKSMLLVRGFSLCGFMANFL ASILTFRTWIENHEIPNTNTTALFVVVYLWNLINLFIFVICQLFVSFFIVRNLWVTGAVL LGVFFFVAGQILTYGFSSQICEGVKHYLDGLFFGSICNIFTLMMVYKTWDITTDDDLEFS VSIDKNGDVLYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Bromo-2- (methylsulfonyl) -4- (trifluoromethyl) benzene
PC1008127-01 1 g

1-Bromo-2- (methylsulfonyl) -4- (trifluoromethyl) benzene

Sign In for Pricing
View Details
1-Bromo-2- (methylsulfonyl) -4- (trifluoromethyl) benzene
PC1008127-02 5 g

1-Bromo-2- (methylsulfonyl) -4- (trifluoromethyl) benzene

Sign In for Pricing
View Details
FGGY (FLJ10986, FGGY Carbohydrate Kinase Domain-containing Protein) (MaxLight 490)
126798-ML490 100 µL

FGGY (FLJ10986, FGGY Carbohydrate Kinase Domain-containing Protein) (MaxLight 490)

Sign In for Pricing
View Details
Duck Lysolecithin ELISA Kit
MBS066357 Inquire

Duck Lysolecithin ELISA Kit

Sign In for Pricing
View Details
Mouse Glutathione Peroxidase 1, GPX1 ELISA Kit
MBS1603781-01 48 Well

Mouse Glutathione Peroxidase 1, GPX1 ELISA Kit

Sign In for Pricing
View Details
Mouse Glutathione Peroxidase 1, GPX1 ELISA Kit
MBS1603781-02 96 Well

Mouse Glutathione Peroxidase 1, GPX1 ELISA Kit

Sign In for Pricing
View Details