Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2L5 (OR2L5)

This Recombinant Human Olfactory receptor 2L5 (OR2L5) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2L5, Olfactory receptor 2L11, Olfactory receptor OR1-53

UniProt

Q8NG80

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENYNQTSTDFILLGLFPPSKIGLFLFILFVLIFLMALIGNLSMILLIFLDTHLHTPMYF LLSQLSLIDLNYISTIVPKMASDFLYGNKSISFIGCGIQSFFFMTFAGAEALLLTSMAYD RYVAICFPLHYPIRMSKRMYVLMITGSWMIGSINSCAHTVYAFRIPYCKSRAINHFFCDV PAMLTLACTDTWVYEYTVFLSSTIFLVFPFTGIACSYGWVLLAVYRMHSAEGRKKAYSTC STHLTVVTFYYAPFAYTYLCPRSLRSLTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGAL TRVIQNIFSVKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC339535 Protein Vector (Human) (pPB-N-His)
PV054578 500 ng

LOC339535 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
GGTLC1 Antibody
orb24267-01 50 µg

GGTLC1 Antibody

Sign In for Pricing
View Details
GGTLC1 Antibody
orb24267-02 100 µg

GGTLC1 Antibody

Sign In for Pricing
View Details
Resistin (RETN) Rat ELISA Kit
G7277 96 Tests

Resistin (RETN) Rat ELISA Kit

Sign In for Pricing
View Details
Human GGCT AssayLite™ Antibody (RPE Conjugate)
32037-05151 5x 30 µg

Human GGCT AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details
Human TSSK4 activation kit by CRISPRa
GA117044 1 Kit

Human TSSK4 activation kit by CRISPRa

Sign In for Pricing
View Details