Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2L5 (OR2L5)

This Recombinant Human Olfactory receptor 2L5 (OR2L5) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2L5, Olfactory receptor 2L11, Olfactory receptor OR1-53

UniProt

Q8NG80

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENYNQTSTDFILLGLFPPSKIGLFLFILFVLIFLMALIGNLSMILLIFLDTHLHTPMYF LLSQLSLIDLNYISTIVPKMASDFLYGNKSISFIGCGIQSFFFMTFAGAEALLLTSMAYD RYVAICFPLHYPIRMSKRMYVLMITGSWMIGSINSCAHTVYAFRIPYCKSRAINHFFCDV PAMLTLACTDTWVYEYTVFLSSTIFLVFPFTGIACSYGWVLLAVYRMHSAEGRKKAYSTC STHLTVVTFYYAPFAYTYLCPRSLRSLTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGAL TRVIQNIFSVKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dengue NS1 (Subtype 1, Dengue virus NS1, NS1) (HRP)
226910-HRP 100 µL

Dengue NS1 (Subtype 1, Dengue virus NS1, NS1) (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Clec12a shRNA (UAS) - Lentiviral mouse Clec12a shRNA (UAS, iRFP) (100)
GTR15288771 1 Vial

Lentiviral mouse Clec12a shRNA (UAS) - Lentiviral mouse Clec12a shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
L3MBTL2 (Lethal (3) malignant Brain Tumor-like Protein 2, H-l (3) mbt-like Protein 2, L (3) mbt-like Protein 2)
128977 100 µg

L3MBTL2 (Lethal (3) malignant Brain Tumor-like Protein 2, H-l (3) mbt-like Protein 2, L (3) mbt-like Protein 2)

Sign In for Pricing
View Details
SERPING1 Rabbit pAb
APA1828-01 30 µL

SERPING1 Rabbit pAb

Sign In for Pricing
View Details
SERPING1 Rabbit pAb
APA1828-02 50 μL

SERPING1 Rabbit pAb

Sign In for Pricing
View Details
SERPING1 Rabbit pAb
APA1828-03 100 µL

SERPING1 Rabbit pAb

Sign In for Pricing
View Details