Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 480 (Olfr480)

This Recombinant Mouse Olfactory receptor 480 (Olfr480) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 480, Odorant receptor S25, Olfactory receptor 204-32

UniProt

Q8VEZ0

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPGNYTVVTEFILLGLTDDITVSVILFVMFLIVYSVTLMGNLNIIVLIRTSPQLHTPMY LFLSHLAFLDIGYSSSVTPIMLRGFLRKGTFIPVAGCVAQLCIVVAFGTSESFLLASMAY DRYVAICSPLLYSTQMSSTVCILLVGTSYLGGWVNAWIFTGCSLNLSFCGPNKINHFFCD YSPLLKLSCSHDFSFEVIPAISSGSIIVVTVFIIALSYVYILVSILKMRSTEGRQKAFST CTSHLTAVTLFFGTITFIYVMPQSSYSTDQNKVVSVFYTVVIPMLNPLIYSFRNKEVKEA MKKLIAKTHWWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tlr6 activation kit by CRISPRa
GA204372 1 Kit

Mouse Tlr6 activation kit by CRISPRa

Sign In for Pricing
View Details
TAF6L Antibody
8C11986-AAT 50 µg

TAF6L Antibody

Sign In for Pricing
View Details
Podophyllotoxin 4-O-Glucoside
TRC-P681010-1MG 1 mg

Podophyllotoxin 4-O-Glucoside

Sign In for Pricing
View Details
Mohawk homeobox (MKX) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H10]
TA808350BM 100 µL

Mohawk homeobox (MKX) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H10]

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF647 conjugate, 0.1mg/mL
BNC472063-500 1x 500 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR561367 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details