Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 480 (Olfr480)

This Recombinant Mouse Olfactory receptor 480 (Olfr480) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 480, Odorant receptor S25, Olfactory receptor 204-32

UniProt

Q8VEZ0

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPGNYTVVTEFILLGLTDDITVSVILFVMFLIVYSVTLMGNLNIIVLIRTSPQLHTPMY LFLSHLAFLDIGYSSSVTPIMLRGFLRKGTFIPVAGCVAQLCIVVAFGTSESFLLASMAY DRYVAICSPLLYSTQMSSTVCILLVGTSYLGGWVNAWIFTGCSLNLSFCGPNKINHFFCD YSPLLKLSCSHDFSFEVIPAISSGSIIVVTVFIIALSYVYILVSILKMRSTEGRQKAFST CTSHLTAVTLFFGTITFIYVMPQSSYSTDQNKVVSVFYTVVIPMLNPLIYSFRNKEVKEA MKKLIAKTHWWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEA5 Antibody
8G875-AAT 50 µg

MAGEA5 Antibody

Sign In for Pricing
View Details
SLC25A4 Human Recombinant Protein, Membrane Nanoparticle
TP721865M 100 µg

SLC25A4 Human Recombinant Protein, Membrane Nanoparticle

Sign In for Pricing
View Details
UBXN2B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F9]
TA502475BM 100 µL

UBXN2B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F9]

Sign In for Pricing
View Details
Casein Kinase 1 alpha (CSNK1A1) (C-term) Rabbit Polyclonal Antibody
AP14042PU-N 400 µL

Casein Kinase 1 alpha (CSNK1A1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,4-Butane Sultone
TRC-B689945-10G 10 g

1,4-Butane Sultone

Sign In for Pricing
View Details
CTBP1 (NM_001012614) Human Over-expression Lysate
LC422883 20 µg

CTBP1 (NM_001012614) Human Over-expression Lysate

Sign In for Pricing
View Details