Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 481 (Olfr481)

This Recombinant Mouse Olfactory receptor 481 (Olfr481) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 481, Olfactory receptor 204-2

UniProt

Q8VGI5

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METENDTMVTEFIILGLTDSATLRAILFVFFLPVYIVTVVGNISIILLIRSSPQLHTPMY LFLSHLAFVDIGYSTSVTPIMLISFLREETTIPLAGCAAQLGSDVAFGTTECFLLATMAY DRYVAICSPLLYSTQMSPAICCFLLGASYLGGCMNASSFTGCFVNLNFCGPNKVNHFFCD LFPLVKLSCGHAYIAEISPSISSASVLVSTLSTIIVSYIYILHSILRMRSAEGRNKAFST CTSHLTAVTLFYGTVLFVYVMPKSSYSADQVKVASVVYTVVIPMLNPLIYSLRNKEVKEA MKKLMARTHWFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSF Rabbit Polyclonal Antibody
TA379328 100 µL

NSF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Ovary
CR815058 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-100 1x 100 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Vas deferens
CS700834 5x 5 µm

Tissue FFPE Sections, Vas deferens

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD49d Antibody[R1-2]
AN00422UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD49d Antibody[R1-2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD49d Antibody[R1-2]
AN00422UL-02 100 µg

Elab Fluor® 488 Anti-Mouse CD49d Antibody[R1-2]

Sign In for Pricing
View Details