Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2L13 (OR2L13)

This Recombinant Human Olfactory receptor 2L13 (OR2L13) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2L13, Olfactory receptor 2L14

UniProt

Q8N349

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKWNHTSNDFILLGLLPPNQTGIFLLCLIILIFFLASVGNSAMIHLIHVDPRLHTPMYF LLSQLSLMDLMYISTTVPKMAYNFLSGQKGISFLGCGVQSFFFLTMACSEGLLLTSMAYD RYLAICHSLYYPIRMSKMMCVKMIGGSWTLGSINSLAHTVFALHIPYCRSRAIDHFFCDV PAMLLLACTDTWVYEYMVFVSTSLFLLFPFIGITSSCGRVLFAVYHMHSKEGRKKAFTTI STHLTVVIFYYAPFVYTYLRPRNLRSPAEDKILAVFYTILTPMLNPIIYSLRNKEVLGAM RRVFGIFSFLKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TMCC1 Protein
E30P02896A 50 µg

Recombinant Human TMCC1 Protein

Sign In for Pricing
View Details
Ap3m2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7047007 1.0 µg DNA

Ap3m2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
DIO2, ID (Type II iodothyronine deiodinase, Type-II 5'-deiodinase, Type 2 DI, DIOII, 5DII, TXDI2, ITDI2, DIO2) (MaxLight 650)
MBS6472468-01 0.1 mL

DIO2, ID (Type II iodothyronine deiodinase, Type-II 5'-deiodinase, Type 2 DI, DIOII, 5DII, TXDI2, ITDI2, DIO2) (MaxLight 650)

Sign In for Pricing
View Details
DIO2, ID (Type II iodothyronine deiodinase, Type-II 5'-deiodinase, Type 2 DI, DIOII, 5DII, TXDI2, ITDI2, DIO2) (MaxLight 650)
MBS6472468-02 5x 0.1 mL

DIO2, ID (Type II iodothyronine deiodinase, Type-II 5'-deiodinase, Type 2 DI, DIOII, 5DII, TXDI2, ITDI2, DIO2) (MaxLight 650)

Sign In for Pricing
View Details
Anti-Human Indoleamine 2,3-Dioxygenase/IDO/INDO
IT-300-193M6-01 0.1 mg

Anti-Human Indoleamine 2,3-Dioxygenase/IDO/INDO

Sign In for Pricing
View Details
Anti-Human Indoleamine 2,3-Dioxygenase/IDO/INDO
IT-300-193M6-02 0.5 mg

Anti-Human Indoleamine 2,3-Dioxygenase/IDO/INDO

Sign In for Pricing
View Details