Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2M3 (OR2M3)

This Recombinant Human Olfactory receptor 2M3 (OR2M3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2M3, Olfactory receptor 2M6, Olfactory receptor OR1-54

UniProt

Q8NG83

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARENSTFNSDFILLGIFNHSPTHTFLFFLVLAIFSVAFMGNSVMVLLIYLDTQLHTPMY LLLSQLSLMDLMLICTTVPKMAFNYLSGSKSISMAGCATQIFFYTSLLGSECFLLAVMAY DRYTAICHPLRYTNLMSPKICGLMTAFSWILGSTDGIIDVVATFSFSYCGSREIAHFFCD FPSLLILSCSDTSIFEKILFICCIVMIVFPVAIIIASYARVILAVIHMGSGEGRRKAFTT CSSHLLVVGMYYGAALFMYIRPTSDRSPTQDKMVSVFYTILTPMLNPLIYSLRNKEVTRA FMKILGKGKSGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKG2A (KLRC1) Human Gene Knockout Kit (CRISPR)
KN203062LP 1 Kit

NKG2A (KLRC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FOXP3 Antibody (Biotin)
KB-3666-01 50 μL

FOXP3 Antibody (Biotin)

Sign In for Pricing
View Details
FOXP3 Antibody (Biotin)
KB-3666-02 100 µL

FOXP3 Antibody (Biotin)

Sign In for Pricing
View Details
FOXP3 Antibody (Biotin)
KB-3666-03 1 mL

FOXP3 Antibody (Biotin)

Sign In for Pricing
View Details
Carbonic Anhydrase VIII (CPTC-CA8-2), CF647 conjugate, 0.1mg/mL
BNC472232-500 1x 500 µL

Carbonic Anhydrase VIII (CPTC-CA8-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EBF3 Rabbit Polyclonal Antibody
TA366628 100 µL

EBF3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details