Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2M7 (OR2M7)

This Recombinant Human Olfactory receptor 2M7 (OR2M7) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2M7, Olfactory receptor OR1-58

UniProt

Q8NG81

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWENQTFNSDFLLLGIFNHSPTHTFLFFLVLAIFSVAFMGNSIMVLLIYLDTQLHTPMY FLLSQLSLMDLMLICTTVPKMAFNYLSGSKSISMAGCATQIFFYISLLGSECFLLAVMSY DRYTAICHPLRYTNLMRPKICGLMTAFSWILGSTDGIIDAVATFSFSYCGSREIAHFCCD FPSLLILSCNDTSIFEEVIFICCIVMLVFPVAIIITSYARVILAVIHMGSGEGRRKAFTT CSSHLMVVGMYYGAGLFMCIQPTSHHSPMQDKMVSVFYTIVTPMLNPLIYSLRNKEVTRA LMKILGKGKSGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal FUR1 Antibody (OTI2D1) [Alexa Fluor 350]
NBP2-72399AF350 0.1 mL

Mouse Monoclonal FUR1 Antibody (OTI2D1) [Alexa Fluor 350]

Sign In for Pricing
View Details
Enkephalin (PENK) (NM_001135690) Human Over-expression Lysate
LH01949V 100 µg

Enkephalin (PENK) (NM_001135690) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-CASP8 (S347) Antibody
MBS7121022-01 0.05 mg

Phospho-CASP8 (S347) Antibody

Sign In for Pricing
View Details
Phospho-CASP8 (S347) Antibody
MBS7121022-02 0.1 mg

Phospho-CASP8 (S347) Antibody

Sign In for Pricing
View Details
Phospho-CASP8 (S347) Antibody
MBS7121022-03 5x 0.1 mg

Phospho-CASP8 (S347) Antibody

Sign In for Pricing
View Details
TA-316 25mg
A13220-25 25 mg

TA-316 25mg

Sign In for Pricing
View Details