Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2L8 (OR2L8)

This Recombinant Human Olfactory receptor 2L8 (OR2L8) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2L8, Olfactory receptor OR1-46

UniProt

Q8NGY9

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENYNQTSTDFILLGLFPPSRIDLFFFILIVFIFLMALIGNLSMILLIFLDTHLHTPMYF LLSQLSLIDLNYISTIVPKMASDFLHGNKSISFTGCGIQSFFFLALGGAEALLLASMAYD RYIAICFPLHYLIRMSKRVCVLMITGSWIIGSINACAHTVYVLHIPYCRSRAINHFFCDV PAMVTLACMDTWVYEGTVFLSATIFLVFPFIGISCSYGQVLFAVYHMKSAEGRKKAYLTC STHLTVVTFYYAPFVYTYLRPRSLRSPTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGAL TRVSQRICSVKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf78 (NM_016482) Human Untagged Clone
SC114245 10 µg

C9orf78 (NM_016482) Human Untagged Clone

Sign In for Pricing
View Details
Nuclear Fast Red
AR-6524-02 50 mL

Nuclear Fast Red

Sign In for Pricing
View Details
Rabbit Polyclonal FDPS Antibody [PE]
NBP2-98461PE 0.1 mL

Rabbit Polyclonal FDPS Antibody [PE]

Sign In for Pricing
View Details
Human TMEM249 knockout cell line
ABC-KH15693 1 Vial

Human TMEM249 knockout cell line

Sign In for Pricing
View Details
KChIP4 shRNA (h) Lentiviral Particles
sc-45837-V 200 µL

KChIP4 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
HPS4 Protein Vector (Mouse) (pPM-C-His)
PV189773 500 ng

HPS4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details