Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2L8 (OR2L8)

This Recombinant Human Olfactory receptor 2L8 (OR2L8) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2L8, Olfactory receptor OR1-46

UniProt

Q8NGY9

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENYNQTSTDFILLGLFPPSRIDLFFFILIVFIFLMALIGNLSMILLIFLDTHLHTPMYF LLSQLSLIDLNYISTIVPKMASDFLHGNKSISFTGCGIQSFFFLALGGAEALLLASMAYD RYIAICFPLHYLIRMSKRVCVLMITGSWIIGSINACAHTVYVLHIPYCRSRAINHFFCDV PAMVTLACMDTWVYEGTVFLSATIFLVFPFIGISCSYGQVLFAVYHMKSAEGRKKAYLTC STHLTVVTFYYAPFVYTYLRPRSLRSPTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGAL TRVSQRICSVKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Modified Duncan Strong (DS) Medium
M1237-500G 500 g

Modified Duncan Strong (DS) Medium

Sign In for Pricing
View Details
Klhl4 3'UTR Lenti-reporter-Luc Vector
25803084 1.0 µg

Klhl4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
LRSAM1 (NM_001190723) Human Over-expression Lysate
LH00093V 100 µg

LRSAM1 (NM_001190723) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Dengue-2 Envelope Hydrophobic Domain
MBS145775-01 0.1 mg

Recombinant Dengue-2 Envelope Hydrophobic Domain

Sign In for Pricing
View Details
Recombinant Dengue-2 Envelope Hydrophobic Domain
MBS145775-02 0.5 mg

Recombinant Dengue-2 Envelope Hydrophobic Domain

Sign In for Pricing
View Details
Recombinant Dengue-2 Envelope Hydrophobic Domain
MBS145775-03 1 mg

Recombinant Dengue-2 Envelope Hydrophobic Domain

Sign In for Pricing
View Details