Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 1F2 (OR1F2P)

This Recombinant Human Putative olfactory receptor 1F2 (OR1F2P) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Putative olfactory receptor 1F2, OLFmf2

UniProt

Q96R84

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERDKPVSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILAISIDSRLHTPMY FFLSNMSFVDNCFSTTVPKMLANHILRTQTISFSGCLMQMYFISELADMDNFLLAVMAYD RFVAVCRPLHYTAKMIHQLCALLVTGSWVVANSNALLHTLLMARLSFCADNTIPHIFCDV TPLLKLSCSDTHLSEVMILTEAALVTITPFLCLLASYMHITCVVLRVPSTKGRWKAFSTC GSHLAVVLLFYGTIMSPYFRTSSSHSAQRDIAAAVRFTVVTPVMNPLIYSLRNKDIKGAL VKVVAVKFFSVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGAM1P4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
36467061 1.0 µg DNA

PGAM1P4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
hnRNP A1 (HNRNPA1) (NM_031157) Human Tagged Lenti ORF Clone
RC211626L4 10 µg

hnRNP A1 (HNRNPA1) (NM_031157) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Protease HtpX (htpX)
MBS1155816 Inquire

Recombinant Protease HtpX (htpX)

Sign In for Pricing
View Details
CPNE7 (NM_014427) Human Tagged ORF Clone
RG212576 10 µg

CPNE7 (NM_014427) Human Tagged ORF Clone

Sign In for Pricing
View Details
ANGPTL8 Mouse Monoclonal Antibody (Biotin)
orb544718 100 µL

ANGPTL8 Mouse Monoclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal Thyroid Peroxidase Antibody (TPO28) [Janelia Fluor 525]
NBP1-50811JF525 0.25 mL

Mouse Monoclonal Thyroid Peroxidase Antibody (TPO28) [Janelia Fluor 525]

Sign In for Pricing
View Details