Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 1F2 (OR1F2P)

This Recombinant Human Putative olfactory receptor 1F2 (OR1F2P) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Putative olfactory receptor 1F2, OLFmf2

UniProt

Q96R84

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERDKPVSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILAISIDSRLHTPMY FFLSNMSFVDNCFSTTVPKMLANHILRTQTISFSGCLMQMYFISELADMDNFLLAVMAYD RFVAVCRPLHYTAKMIHQLCALLVTGSWVVANSNALLHTLLMARLSFCADNTIPHIFCDV TPLLKLSCSDTHLSEVMILTEAALVTITPFLCLLASYMHITCVVLRVPSTKGRWKAFSTC GSHLAVVLLFYGTIMSPYFRTSSSHSAQRDIAAAVRFTVVTPVMNPLIYSLRNKDIKGAL VKVVAVKFFSVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium 3-mercaptopropanesulphonate
abx184367-01 100 g

Sodium 3-mercaptopropanesulphonate

Sign In for Pricing
View Details
Sodium 3-mercaptopropanesulphonate
abx184367-02 500 g

Sodium 3-mercaptopropanesulphonate

Sign In for Pricing
View Details
TEAD2, Human (Depalmitoylated, sf9)
HY-P703247 1 Each

TEAD2, Human (Depalmitoylated, sf9)

Sign In for Pricing
View Details
Rabbit Polyclonal TFIP11 Antibody
NBP2-86861 100 µL

Rabbit Polyclonal TFIP11 Antibody

Sign In for Pricing
View Details
Recombinant Human ITGB6, N-His
MBS1573523-01 0.1 mg

Recombinant Human ITGB6, N-His

Sign In for Pricing
View Details
Recombinant Human ITGB6, N-His
MBS1573523-02 1 mg

Recombinant Human ITGB6, N-His

Sign In for Pricing
View Details