Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2L3 (OR2L3)

This Recombinant Human Olfactory receptor 2L3 (OR2L3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2L3

UniProt

Q8NG85

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENYNQTSTDFILLGFFPPSRIGLFLFILIVFIFLMALIGNLSMILLIFLDTHLHTPMYF LLSQLSLIDLNYISTIVPKMASDFLSGNKSISFTGCGIQSFFFSALGGAEALLLASMAYD RYIAICFPLHYPIRMSKRMCVLMITGSWIIGSINACAHTVYVLHIPYCQSRAINHFFCDV PAMVTLACMDTWVYEGTVFLSTTIFLVFPFIAISCSYGRVLLAVYHMKSAEGRKKAYLTC STHLTVVTFYYAPFVYTYLRPRSLRSPTEDKVLAVFYTTLTPMLNPIIYSLRNKEVMGAL TRVSQRICSGKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AOC2 (NM_009590) Human Recombinant Protein
TP322991 20 µg

AOC2 (NM_009590) Human Recombinant Protein

Sign In for Pricing
View Details
PKC beta 1 (PRKCB) (NM_002738) Human Over-expression Lysate
LY419133 100 µg

PKC beta 1 (PRKCB) (NM_002738) Human Over-expression Lysate

Sign In for Pricing
View Details
Econazole Nitrate-d6
TRC-E326002-1MG 1 mg

Econazole Nitrate-d6

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS710319 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
TRF4 2 (PAPD5) Human Gene Knockout Kit (CRISPR)
KN214986 1 Kit

TRF4 2 (PAPD5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CEACAM3 Antibody
KC-16300-01 50 μL

CEACAM3 Antibody

Sign In for Pricing
View Details