Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 7D4 (OR7D4)

This Recombinant Human Olfactory receptor 7D4 (OR7D4) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 7D4, OR19-B, Odorant receptor family subfamily D member 4RT, Olfactory receptor OR19-7

UniProt

Q8NG98

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAENLTELSKFLLLGLSDDPELQPVLFGLFLSMYLVTVLGNLLIILAVSSDSHLHTPMY FFLSNLSFVDICFISTTVPKMLVSIQARSKDISYMGCLTQVYFLMMFAGMDTFLLAVMAY DRFVAICHPLHYTVIMNPCLCGLLVLASWFIIFWFSLVHILLMKRLTFSTGTEIPHFFCE PAQVLKVACSNTLLNNIVLYVATALLGVFPVAGILFSYSQIVSSLMGMSSTKGKYKAFST CGSHLCVVSLFYGTGLGVYLSSAVTHSSQSSSTASVMYAMVTPMLNPFIYSLRNKDVKGA LERLLSRADSCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Bovine IgG (H&L) - Affinity Pure, ALP Conjugate
MBS687040-01 1 mg

Rabbit anti-Bovine IgG (H&L) - Affinity Pure, ALP Conjugate

Sign In for Pricing
View Details
Rabbit anti-Bovine IgG (H&L) - Affinity Pure, ALP Conjugate
MBS687040-02 5x 1 mg

Rabbit anti-Bovine IgG (H&L) - Affinity Pure, ALP Conjugate

Sign In for Pricing
View Details
beta-Hydroxybutyrate Assay Kit (Colorimetric)
NBP3-25919 96 Tests

beta-Hydroxybutyrate Assay Kit (Colorimetric)

Sign In for Pricing
View Details
CDH12 CRISPR Knock Out 293T Cell Line (Human)
15650141 1x 10^6 Cells / 1.0 mL

CDH12 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
ERK2 Polyclonal Antibody, Cy5 Conjugated
bs-24463R-Cy5 100 µL

ERK2 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Acivicin
MBS565653-01 10 mg

Acivicin

Sign In for Pricing
View Details