Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 7D4 (OR7D4)

This Recombinant Human Olfactory receptor 7D4 (OR7D4) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 7D4, OR19-B, Odorant receptor family subfamily D member 4RT, Olfactory receptor OR19-7

UniProt

Q8NG98

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAENLTELSKFLLLGLSDDPELQPVLFGLFLSMYLVTVLGNLLIILAVSSDSHLHTPMY FFLSNLSFVDICFISTTVPKMLVSIQARSKDISYMGCLTQVYFLMMFAGMDTFLLAVMAY DRFVAICHPLHYTVIMNPCLCGLLVLASWFIIFWFSLVHILLMKRLTFSTGTEIPHFFCE PAQVLKVACSNTLLNNIVLYVATALLGVFPVAGILFSYSQIVSSLMGMSSTKGKYKAFST CGSHLCVVSLFYGTGLGVYLSSAVTHSSQSSSTASVMYAMVTPMLNPFIYSLRNKDVKGA LERLLSRADSCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCTK1 (CDK16, Cyclin-dependent Kinase 16, Cell Division Protein Kinase 16, PCTAIRE-motif Protein Kinase 1, Serine/Threonine-protein Kinase PCTAIRE-1, FLJ16665, PCTAIRE, PCTAIRE1, PCTGAIRE) (Biotin)
131015-Biotin 100 µL

PCTK1 (CDK16, Cyclin-dependent Kinase 16, Cell Division Protein Kinase 16, PCTAIRE-motif Protein Kinase 1, Serine/Threonine-protein Kinase PCTAIRE-1, FLJ16665, PCTAIRE, PCTAIRE1, PCTGAIRE) (Biotin)

Sign In for Pricing
View Details
BRF2 ELISA Kit (Human) (OKCA01553)
OKCA01553 96 Well

BRF2 ELISA Kit (Human) (OKCA01553)

Sign In for Pricing
View Details
ST7 CRISPR/Cas9 KO Plasmid (m)
sc-425684 20 µg

ST7 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
SNX16 siRNA (Mouse)
MBS8208163-01 15 nmol

SNX16 siRNA (Mouse)

Sign In for Pricing
View Details
SNX16 siRNA (Mouse)
MBS8208163-02 30 nmol

SNX16 siRNA (Mouse)

Sign In for Pricing
View Details
SNX16 siRNA (Mouse)
MBS8208163-03 5x 30 nmol

SNX16 siRNA (Mouse)

Sign In for Pricing
View Details