Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10C1 (OR10C1)

This Recombinant Human Olfactory receptor 10C1 (OR10C1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 10C1, Hs6M1-17, Olfactory receptor 10C2

UniProt

Q96KK4

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANTSMVTEFLLLGFSHLADLQGLLFSVFLTIYLLTVAGNFLIVVLVSTDAALQSPMYF FLRTLSALEIGYTSVTVPLLLHHLLTGRRHISRSGCALQMFFFLFFGATECCLLAAMAYD RYAAICEPLRYPLLLSHRVCLQLAGSAWACGVLVGLGHTPFIFSLPFCGPNTIPQFFCEI QPVLQLVCGDTSLNELQIILATALLILCPFGLILGSYGRILVTIFRIPSVAGRRKAFSTC SSHLIMVSLFYGTALFIYIRPKASYDPATDPLVSLFYAVVTPILNPIIYSLRNTEVKAAL KRTIQKTVPMEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary: left
CR562457 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
Recombinant Phospho-eEF2 (Thr56) Monoclonal Antibody
AN300155L-01 20 µL

Recombinant Phospho-eEF2 (Thr56) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Phospho-eEF2 (Thr56) Monoclonal Antibody
AN300155L-02 100 µL

Recombinant Phospho-eEF2 (Thr56) Monoclonal Antibody

Sign In for Pricing
View Details
1,2-Dimyristoyl-sn-glycero-3-phosphate Sodium Salt
TRC-D479655-25MG 25 mg

1,2-Dimyristoyl-sn-glycero-3-phosphate Sodium Salt

Sign In for Pricing
View Details
SNX18 Human Gene Knockout Kit (CRISPR)
KN419150 1 Kit

SNX18 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytochrome P450 3A4 (CYP3A4) Rabbit Polyclonal Antibody
AP14581PU-N 200 µL

Cytochrome P450 3A4 (CYP3A4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details