Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C1 (OR6C1)

This Recombinant Human Olfactory receptor 6C1 (OR6C1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6C1, OST267

UniProt

Q96RD1

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNHTEITEFILLGLTDDPNFQVVIFVFLLITYMLSITGNLTLITITLLDSHLQTPMYFF LRNFSILEISFTTVSIPKFLGNIISGDKTISFNNCIVQLFFFILLGVTEFYLLAAMSYDR YVAICKPLHCLSIMNRRVCTLLVFTSWLVSFLIIFPALMLLLKLHYCRSNIIDHFTCDYF PLLQLACSDTKFLEVMGFSCAAFTLMFTLALIFLSYIYIIRTILRIPSTSQRTKAFSTCS SHMVVVSISYGSCIFMYIKPSAKDRVSLSKGVAILNTSVAPMMNPFIYSLRNQQVKQAFI NMARKTVFFTST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,7,4'-Trihydroxyflavone 50mg
A19936-50 50 mg

3,7,4'-Trihydroxyflavone 50mg

Sign In for Pricing
View Details
MOGT1 Antibody - C-terminal region
OAAB07563-400UL 400 µL

MOGT1 Antibody - C-terminal region

Sign In for Pricing
View Details
Furaptra (Mag-Fura-2), tetrasodium salt
F1760 1 mg

Furaptra (Mag-Fura-2), tetrasodium salt

Sign In for Pricing
View Details
GSTM1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0913502 1.0 µg DNA

GSTM1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Anti-SMAD4 Antibody
CPA5550-01 30 µL

Anti-SMAD4 Antibody

Sign In for Pricing
View Details
Anti-SMAD4 Antibody
CPA5550-02 50 μL

Anti-SMAD4 Antibody

Sign In for Pricing
View Details