Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8H3 (OR8H3)

This Recombinant Human Olfactory receptor 8H3 (OR8H3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 8H3, Olfactory receptor OR11-172

UniProt

Q8N146

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGRRNDTNVADFILTGLSDSEEVQMALFMLFLLIYLITMLGNVGMLLIIRLDLQLHTPM YFFLTHLSFIDLSYSTVVTPKTLANLLTSNYISFTGCFAQMFCFVFLGTAECYLLSSMAY DRYAAICSPLHYTVIMPKRLCLALITGPYVIGFMDSFVNVVSMSRLHFCDSNIIHHFFCD TSPILALSCTDTDNTEMLIFIIAGSTLMVSLITISASYVSILSTILKINSTSGKQKAFST CVSHLLGVTIFYGTMIFTYLKPRKSYSLGRDQVAPVFYTIVIPMLNPLIYSLRNREVKNA LIRVMQRRQDSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6V1 Human Gene Knockout Kit (CRISPR)
KN418286 1 Kit

OR6V1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD62L Antibody[DREG56]
E-AB-F1051L-01 20 Tests

Elab Fluor® 488 Anti-Human CD62L Antibody[DREG56]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD62L Antibody[DREG56]
E-AB-F1051L-02 100 Tests

Elab Fluor® 488 Anti-Human CD62L Antibody[DREG56]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD62L Antibody[DREG56]
E-AB-F1051L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD62L Antibody[DREG56]

Sign In for Pricing
View Details
SON Human Gene Knockout Kit (CRISPR)
KN416844 1 Kit

SON Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C13orf18 (RUBCNL) Human Gene Knockout Kit (CRISPR)
KN424552 1 Kit

C13orf18 (RUBCNL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details