Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8H3 (OR8H3)

This Recombinant Human Olfactory receptor 8H3 (OR8H3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 8H3, Olfactory receptor OR11-172

UniProt

Q8N146

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGRRNDTNVADFILTGLSDSEEVQMALFMLFLLIYLITMLGNVGMLLIIRLDLQLHTPM YFFLTHLSFIDLSYSTVVTPKTLANLLTSNYISFTGCFAQMFCFVFLGTAECYLLSSMAY DRYAAICSPLHYTVIMPKRLCLALITGPYVIGFMDSFVNVVSMSRLHFCDSNIIHHFFCD TSPILALSCTDTDNTEMLIFIIAGSTLMVSLITISASYVSILSTILKINSTSGKQKAFST CVSHLLGVTIFYGTMIFTYLKPRKSYSLGRDQVAPVFYTIVIPMLNPLIYSLRNREVKNA LIRVMQRRQDSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant c-Jun Antibody
RC-4167-01 50 μL

Recombinant c-Jun Antibody

Sign In for Pricing
View Details
Recombinant c-Jun Antibody
RC-4167-02 100 µL

Recombinant c-Jun Antibody

Sign In for Pricing
View Details
Recombinant c-Jun Antibody
RC-4167-03 1 mL

Recombinant c-Jun Antibody

Sign In for Pricing
View Details
Ethyl 3-(Butanoylamino)-2-oxobutanoate
TRC-E900565-5G 5 g

Ethyl 3-(Butanoylamino)-2-oxobutanoate

Sign In for Pricing
View Details
Glycyrrhetic Acid 3-O-Beta-D-Glucuronide
TRC-G735010-5MG 5 mg

Glycyrrhetic Acid 3-O-Beta-D-Glucuronide

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), 1mg/mL
BNUM1526-50 1x 50 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), 1mg/mL

Sign In for Pricing
View Details