Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4F6 (OR4F6)

This Recombinant Human Olfactory receptor 4F6 (OR4F6) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 4F6, Olfactory receptor 4F12, Olfactory receptor OR15-15

UniProt

Q8NGB9

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDEANHSVVSEFVFLGLSDSRKIQLLLFLFFSVFYVSSLMGNLLIVLTVTSDPRLQSPMY FLLANLSIINLVFCSSTAPKMIYDLFRKHKTISFGGCVVQIFFIHAVGGTEMVLLIAMAF DRYVAICKPLHYLTIMNPQRCILFLVISWIIGIIHSVIQLAFVVDLLFCGPNELDSFFCD LPRFIKLACIETYTLGFMVTANSGFISLASFLILIISYIFILVTVQKKSSGGIFKAFSML SAHVIVVVLVFGPLIFFYIFPFPTSHLDKFLAIFDAVITPVLNPVIYTFRNKEMMVAMRR RCSQFVNYSKIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2,3-Triazolo (1,5-a) pyridine
sc-258913A 5 g

1,2,3-Triazolo (1,5-a) pyridine

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. indica Cytochrome b6 (petB)
MBS7025724-01 0.02 mg

Recombinant Oryza sativa subsp. indica Cytochrome b6 (petB)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. indica Cytochrome b6 (petB)
MBS7025724-02 0.1 mg

Recombinant Oryza sativa subsp. indica Cytochrome b6 (petB)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. indica Cytochrome b6 (petB)
MBS7025724-03 5x 0.1 mg

Recombinant Oryza sativa subsp. indica Cytochrome b6 (petB)

Sign In for Pricing
View Details
Human CHAC1 (Glutathione-specific gamma-glutamylcyclotransferase 1) ELISA kit
orb1784692-01 48 Tests

Human CHAC1 (Glutathione-specific gamma-glutamylcyclotransferase 1) ELISA kit

Sign In for Pricing
View Details
Human CHAC1 (Glutathione-specific gamma-glutamylcyclotransferase 1) ELISA kit
orb1784692-02 96 Tests

Human CHAC1 (Glutathione-specific gamma-glutamylcyclotransferase 1) ELISA kit

Sign In for Pricing
View Details