Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6N1 (OR6N1)

This Recombinant Human Olfactory receptor 6N1 (OR6N1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6N1

UniProt

Q8NGY5

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTGNWSQVAEFIILGFPHLQGVQIYLFLLLLLIYLMTVLGNLLIFLVVCLDSRLHTPMY HFVSILSFSELGYTAATIPKMLANLLSEKKTISFSGCLLQIYFFHSLGATECYLLTAMAY DRYLAICRPLHYPTLMTPTLCAEIAIGCWLGGLAGPVVEISLISRLPFCGPNRIQHVFCD FPPVLSLACTDTSINVLVDFVINSCKILATFLLILCSYVQIICTVLRIPSAAGKRKAIST CASHFTVVLIFYGSILSMYVQLKKSYSLDYDQALAVVYSVLTPFLNPFIYSLRNKEIKEA VRRQLKRIGILA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOH12CR2 Recombinant Protein (Human)
RP069144 100 µg

LOH12CR2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Arylsulfatase I Polyclonal Antibody
E44H04034 100 µL

Arylsulfatase I Polyclonal Antibody

Sign In for Pricing
View Details
Human Ubiquitin-conjugating enzyme E2 A (UBE2A) ELISA Kit
AE12548HU-01 48 Tests

Human Ubiquitin-conjugating enzyme E2 A (UBE2A) ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin-conjugating enzyme E2 A (UBE2A) ELISA Kit
AE12548HU-02 96 Tests

Human Ubiquitin-conjugating enzyme E2 A (UBE2A) ELISA Kit

Sign In for Pricing
View Details
MFluor™ Red 780 Anti-human CD24 Antibody *HI45*
102400W0-AAT 100 Tests

MFluor™ Red 780 Anti-human CD24 Antibody *HI45*

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. syringae 3-isopropylmalate dehydratase small subunit (leuD)
MBS1435624-01 0.02 mg (E-Coli)

Recombinant Pseudomonas syringae pv. syringae 3-isopropylmalate dehydratase small subunit (leuD)

Sign In for Pricing
View Details