Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6N1 (OR6N1)

This Recombinant Human Olfactory receptor 6N1 (OR6N1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6N1

UniProt

Q8NGY5

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTGNWSQVAEFIILGFPHLQGVQIYLFLLLLLIYLMTVLGNLLIFLVVCLDSRLHTPMY HFVSILSFSELGYTAATIPKMLANLLSEKKTISFSGCLLQIYFFHSLGATECYLLTAMAY DRYLAICRPLHYPTLMTPTLCAEIAIGCWLGGLAGPVVEISLISRLPFCGPNRIQHVFCD FPPVLSLACTDTSINVLVDFVINSCKILATFLLILCSYVQIICTVLRIPSAAGKRKAIST CASHFTVVLIFYGSILSMYVQLKKSYSLDYDQALAVVYSVLTPFLNPFIYSLRNKEIKEA VRRQLKRIGILA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC102A Antibody (C-term) Blocking peptide
MBS9218293-01 0.5 mg

CCDC102A Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
CCDC102A Antibody (C-term) Blocking peptide
MBS9218293-02 5x 0.5 mg

CCDC102A Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
Arsi-set siRNA/shRNA/RNAi Lentivector (Rat)
12471096 4x 500 ng

Arsi-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
ADAT1, NT (ADAT1, tRNA-specific adenosine deaminase 1, tRNA-specific adenosine-37 deaminase) (Azide free) (HRP)
MBS6271611-01 0.2 mL

ADAT1, NT (ADAT1, tRNA-specific adenosine deaminase 1, tRNA-specific adenosine-37 deaminase) (Azide free) (HRP)

Sign In for Pricing
View Details
ADAT1, NT (ADAT1, tRNA-specific adenosine deaminase 1, tRNA-specific adenosine-37 deaminase) (Azide free) (HRP)
MBS6271611-02 5x 0.2 mL

ADAT1, NT (ADAT1, tRNA-specific adenosine deaminase 1, tRNA-specific adenosine-37 deaminase) (Azide free) (HRP)

Sign In for Pricing
View Details
Cyp2a3 ORF Vector (Rat) (pORF)
ORF065693 1.0 µg DNA

Cyp2a3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details