Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 958 (Olfr958)

This Recombinant Mouse Olfactory receptor 958 (Olfr958) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 958, Olfactory receptor 224-9

UniProt

Q8VEY3

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIKNCSVVTEFILLGIPHTEGFETLLFVLFLPFYACTLVGNVSILVAVISSTRLHTPMY FFLGNLSVFDMGFSSVTCPKMLFYLMGLSRLISYQDCVSQLFFFHFLGSIECFLYTVMAY DRFAAICHPLRYSVIMNSKICVALAVGTWLLGCFHSSVLTSLTFTLPYCGPNEVDHFFCD IPAILPLASADTSLAQRVSFTNVGLVSLVCFLLILLSYTRITISILSIQSTEGRQRAFST CSAHLIAILCAYGPIITIYLQPTPNPMLGTVVQILMNLVGPMLNPLIYTLRNKEVKIALK KILHGKGSVSEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABLIM2 (NM_001130087) Human Over-expression Lysate
LY427155 100 µg

ABLIM2 (NM_001130087) Human Over-expression Lysate

Sign In for Pricing
View Details
EvaGreen®, 20X in Water, 5x1 mL
#31000 5x 1 mL

EvaGreen®, 20X in Water, 5x1 mL

Sign In for Pricing
View Details
Importin 13 (IPO13) Human Gene Knockout Kit (CRISPR)
KN401577 1 Kit

Importin 13 (IPO13) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-(4-Aminophenyl)propanoic Acid
TRC-A622690-1G 1 g

2-(4-Aminophenyl)propanoic Acid

Sign In for Pricing
View Details
LIM domain only 3 (LMO3) (NM_018640) Human Recombinant Protein
TP305190L 1 mg

LIM domain only 3 (LMO3) (NM_018640) Human Recombinant Protein

Sign In for Pricing
View Details
BCL2L13 Antibody
KC-21407-01 50 μL

BCL2L13 Antibody

Sign In for Pricing
View Details