Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 958 (Olfr958)

This Recombinant Mouse Olfactory receptor 958 (Olfr958) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 958, Olfactory receptor 224-9

UniProt

Q8VEY3

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIKNCSVVTEFILLGIPHTEGFETLLFVLFLPFYACTLVGNVSILVAVISSTRLHTPMY FFLGNLSVFDMGFSSVTCPKMLFYLMGLSRLISYQDCVSQLFFFHFLGSIECFLYTVMAY DRFAAICHPLRYSVIMNSKICVALAVGTWLLGCFHSSVLTSLTFTLPYCGPNEVDHFFCD IPAILPLASADTSLAQRVSFTNVGLVSLVCFLLILLSYTRITISILSIQSTEGRQRAFST CSAHLIAILCAYGPIITIYLQPTPNPMLGTVVQILMNLVGPMLNPLIYTLRNKEVKIALK KILHGKGSVSEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histo-Clear II
NAT1336 5 US Gallon - 18.9 L

Histo-Clear II

Sign In for Pricing
View Details
HLA-DRB (LN-3 + HLA-DRB/1067), CF488A conjugate, 0.1mg/mL
BNC881208-500 1x 500 µL

HLA-DRB (LN-3 + HLA-DRB/1067), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HGS (NM_004712) Human Over-expression Lysate
LY401488 100 µg

HGS (NM_004712) Human Over-expression Lysate

Sign In for Pricing
View Details
D-Xylonic Acid Calcium Salt Hydrate
TRC-X750000-2.5G 2.5 g

D-Xylonic Acid Calcium Salt Hydrate

Sign In for Pricing
View Details
NOL10 Antibody
8C17154-AAT 50 µg

NOL10 Antibody

Sign In for Pricing
View Details
SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]
TA800125AM 100 µL

SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]

Sign In for Pricing
View Details