Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member B3 (Mrgprb3)

This Recombinant Mouse Mas-related G-protein coupled receptor member B3 (Mrgprb3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member B3

UniProt

Q91ZC1

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALRTSLITTTAPDKTSLPISICIIKFQVMNLLSITISPVGMVLNIIVLWFLGFQICRNA FSAYILNLAVADFLFLCSHSIFSFLIVCKLHYFLFYIRQLLDTVTMFAYVFGLSITTIIS IECCLSIMWPIWYHCQRPRHTSAVICVLLWALSLLFPALQMEKCSVLFNTFEYSWCGIIN IISGAWLVVLFVVLCGFSLILLLRISCGSQQIPVTRLNVTIALRVLLLLIFGIPFGIFWI VDKWNEENFFVRACGFSHHILYVYCINICVNATIYFLVGSIRHGKFQKMTLKLILQRAIQ GTPEEEGGERGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-100 1x 100 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL
BNC942853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF647 conjugate, 0.1mg/mL
BNC470032-500 1x 500 µL

MUC2 (CCP58), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF568 conjugate, 0.1mg/mL
BNC682340-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM29 (TRIM29/1041), CF640R conjugate, 0.1mg/mL
BNC401041-500 1x 500 µL

TRIM29 (TRIM29/1041), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details