Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4P4 (OR4P4)

This Recombinant Human Olfactory receptor 4P4 (OR4P4) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 4P4, Olfactory receptor 4P3

UniProt

Q8NGL7

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKSNNSTLFILLGFSQNKNIEVLCFVLFLFCYIAIWMGNLLIMISITCTQLIHQPMYFF LNYLSLSDLCYTSTVTPKLMVDLLAERKTISYNNCMIQLFTTHFFGGIEIFILTGMAYDR YVAICKPLHYTIIMSRQKCNTIIIVCCTGGFIHSASQFLLTIFVPFCGPNEIDHYFCDVY PLLKLACSNIHMIGLLVIANSGLIALVTFVVLLLSYVFILYTIRAYSAERRSKALATCSS HVIVVVLFFAPALFIYIRPVTTFSEDKVFALFYTIIAPMFNPLIYTLRNTEMKNAMRKVW CCQILLKRNQLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LYVE-1 Antibody [DyLight 650]
NB100-725C 0.1 mL

Rabbit Polyclonal LYVE-1 Antibody [DyLight 650]

Sign In for Pricing
View Details
GENLISA™ Human Vascular Endothelial Growth Factor 165 (VEGF165) ELISA
KBH0052 1x 96 Well

GENLISA™ Human Vascular Endothelial Growth Factor 165 (VEGF165) ELISA

Sign In for Pricing
View Details
Human UCHL1 Protein, His Tag
KMPH6420-01 20 µg

Human UCHL1 Protein, His Tag

Sign In for Pricing
View Details
Human UCHL1 Protein, His Tag
KMPH6420-02 50 µg

Human UCHL1 Protein, His Tag

Sign In for Pricing
View Details
Hsa-miR-6876-3p miRNA Antagomir
orb1913894-01 10 nmol

Hsa-miR-6876-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-6876-3p miRNA Antagomir
orb1913894-02 20 nmol

Hsa-miR-6876-3p miRNA Antagomir

Sign In for Pricing
View Details