Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4P4 (OR4P4)

This Recombinant Human Olfactory receptor 4P4 (OR4P4) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 4P4, Olfactory receptor 4P3

UniProt

Q8NGL7

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKSNNSTLFILLGFSQNKNIEVLCFVLFLFCYIAIWMGNLLIMISITCTQLIHQPMYFF LNYLSLSDLCYTSTVTPKLMVDLLAERKTISYNNCMIQLFTTHFFGGIEIFILTGMAYDR YVAICKPLHYTIIMSRQKCNTIIIVCCTGGFIHSASQFLLTIFVPFCGPNEIDHYFCDVY PLLKLACSNIHMIGLLVIANSGLIALVTFVVLLLSYVFILYTIRAYSAERRSKALATCSS HVIVVVLFFAPALFIYIRPVTTFSEDKVFALFYTIIAPMFNPLIYTLRNTEMKNAMRKVW CCQILLKRNQLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM76A Recombinant Protein (Rat)
RP200762 100 µg

FAM76A Recombinant Protein (Rat)

Sign In for Pricing
View Details
C4orf26 3'UTR Luciferase Stable Cell Line
TU002306 1.0 mL

C4orf26 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
KRT16 siRNA (Human)
MBS8223567-01 15 nmol

KRT16 siRNA (Human)

Sign In for Pricing
View Details
KRT16 siRNA (Human)
MBS8223567-02 30 nmol

KRT16 siRNA (Human)

Sign In for Pricing
View Details
KRT16 siRNA (Human)
MBS8223567-03 5x 30 nmol

KRT16 siRNA (Human)

Sign In for Pricing
View Details
YRDCP2 Recombinant Protein (Human)
RP108062 100 µg

YRDCP2 Recombinant Protein (Human)

Sign In for Pricing
View Details