Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4P4 (OR4P4)

This Recombinant Human Olfactory receptor 4P4 (OR4P4) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 4P4, Olfactory receptor 4P3

UniProt

Q8NGL7

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKSNNSTLFILLGFSQNKNIEVLCFVLFLFCYIAIWMGNLLIMISITCTQLIHQPMYFF LNYLSLSDLCYTSTVTPKLMVDLLAERKTISYNNCMIQLFTTHFFGGIEIFILTGMAYDR YVAICKPLHYTIIMSRQKCNTIIIVCCTGGFIHSASQFLLTIFVPFCGPNEIDHYFCDVY PLLKLACSNIHMIGLLVIANSGLIALVTFVVLLLSYVFILYTIRAYSAERRSKALATCSS HVIVVVLFFAPALFIYIRPVTTFSEDKVFALFYTIIAPMFNPLIYTLRNTEMKNAMRKVW CCQILLKRNQLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P15RS (C-6)
sc-514724 200 µg/mL

P15RS (C-6)

Sign In for Pricing
View Details
OST4 (m) -PR
sc-108670-PR 10 µM - 20 µL

OST4 (m) -PR

Sign In for Pricing
View Details
Sheep Pentraxin 3, Long ELISA Kit
MBS068178-01 48 Well

Sheep Pentraxin 3, Long ELISA Kit

Sign In for Pricing
View Details
Sheep Pentraxin 3, Long ELISA Kit
MBS068178-02 96 Well

Sheep Pentraxin 3, Long ELISA Kit

Sign In for Pricing
View Details
Sheep Pentraxin 3, Long ELISA Kit
MBS068178-03 5x 96 Well

Sheep Pentraxin 3, Long ELISA Kit

Sign In for Pricing
View Details
Sheep Pentraxin 3, Long ELISA Kit
MBS068178-04 10x 96 Well

Sheep Pentraxin 3, Long ELISA Kit

Sign In for Pricing
View Details