Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 39 (Tas2r39)

This Recombinant Rat Taste receptor type 2 member 39 (Tas2r39) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 39, T2R39, Taste receptor type 2 member 32, T2R32

UniProt

Q67ER9

Expression Region

1-319

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQPSNYWKQDLLPLSILILTLVATECTIGIIASGIITVVNAVSWVQKRAVSITTRILLL LSVSRIGLQSIILIEMTSSIFNFSSYNSVLYRVSRVSFVFLNYCSLWFAALLSFFHFVKI ANFSYPLFFKLKWRISELMPWLLWLSVFISFSSSMFFCNHKYTVYNNISLSSNICNFTME LYVAEANVVNVAFLFSFGILPPLTMFIATATLLIFSLRRHTLHMRNGDADSRNPRVEAHK QAIKETSCFLFLYILYAAVLFLSTSNIADASLFWSSVLRISLPVYPAGHSVLLIQSNPGL KRTWKQLLSQIHLHLQSRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-100 1x 100 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
BNC470050-500 1x 500 µL

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-500 1x 500 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL
BNC940994-100 1x 100 µL

TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details