Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 39 (Tas2r39)

This Recombinant Mouse Taste receptor type 2 member 39 (Tas2r39) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 39, T2R39, mT2R34

UniProt

Q7TQA5

Expression Region

1-319

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQPSNYWKQDVLPLSILMLTLVATECTIGIIASGIVMAVNAVSWVQKKAISITTRILLL LSVSRIGLQSIMLIEITSSIFNVAFYNSVLYRVSNVSFVFLNYCSLWFAALLSFFHFVKI ANFSYPLFFKLKWRISELMPWLLWLSVFISFSSSMFFSKHKFTVNNNNSLSNNICNFTMK LYVVETNVVNVSFLFISGILPPLTMFVATATLLIFSLRRHTLNMRNSATGSRNPCIEAHM QAIKETSCFLFLYILNAAALLLSTSNIVDASLFWSIVIRIVLPVYPAGHSVLLIQNNPGL RRTWKHLQSQIHLYLQNRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-500 1x 500 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (rMX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC882562-500 1x 500 µL

CD63 (Late Endosomes Marker) (rMX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (31G7), CF594 conjugate, 0.1mg/mL
BNC941194-500 1x 500 µL

EGFR (31G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II, Mouse (MK-D6), CF405S conjugate, 0.1mg/mL
BNC042007-500 1x 500 µL

MHC II, Mouse (MK-D6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details