Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 52L2 (OR52L2P)

This Recombinant Human Putative olfactory receptor 52L2 (OR52L2P) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Putative olfactory receptor 52L2, Olfactory receptor OR11-74

UniProt

Q8NGH6

Expression Region

1-319

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLDSFFSFLLKSLIMALSNSSWRLPQPSFFLVGIPGLEESQHWIALPLGILYLLALVGN VTILFIIWMDPSLHQSMYLFLSMLAAIDLVVASSTAPKALAVLLVRAQEIGYTVCLIQMF FTHAFSSMESGVLVAMALDRYVAICHPLHHSTILHPGVIGHIGMVVLVRGLLLLIPFLIL LRKLIFCQATIIGHAYCEHMAVVKLACSETTVNRAYGLTVALLVVGLDVLAIGVSYAHIL QAVLKVPGNEARLKAFSTCGSHVCVILVFYIPGMFSFLTHRFGHHVPHHVHVLLAILYRL VPPALNPLVYRVKTQKIHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Ethoxy-2- (1,1,2,2-tetrafluoroethoxy) ethane
PC106584 1 Each

1-Ethoxy-2- (1,1,2,2-tetrafluoroethoxy) ethane

Sign In for Pricing
View Details
TAB29 10mg
A18467-10 10 mg

TAB29 10mg

Sign In for Pricing
View Details
MYO19 (NM_001163735) Human Tagged ORF Clone
RG228626 10 µg

MYO19 (NM_001163735) Human Tagged ORF Clone

Sign In for Pricing
View Details
Trp63 Protein Vector (Mouse) (pPM-C-HA)
PV241960 500 ng

Trp63 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CD300LB ELISA Kit (Mouse) (OKEH03622)
OKEH03622 96 Well

CD300LB ELISA Kit (Mouse) (OKEH03622)

Sign In for Pricing
View Details
RASD2 Polyclonal Antibody Cy3 Conjugated
MBS9461794-01 0.1 mL

RASD2 Polyclonal Antibody Cy3 Conjugated

Sign In for Pricing
View Details