Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 52L2 (OR52L2P)

This Recombinant Human Putative olfactory receptor 52L2 (OR52L2P) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Putative olfactory receptor 52L2, Olfactory receptor OR11-74

UniProt

Q8NGH6

Expression Region

1-319

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLDSFFSFLLKSLIMALSNSSWRLPQPSFFLVGIPGLEESQHWIALPLGILYLLALVGN VTILFIIWMDPSLHQSMYLFLSMLAAIDLVVASSTAPKALAVLLVRAQEIGYTVCLIQMF FTHAFSSMESGVLVAMALDRYVAICHPLHHSTILHPGVIGHIGMVVLVRGLLLLIPFLIL LRKLIFCQATIIGHAYCEHMAVVKLACSETTVNRAYGLTVALLVVGLDVLAIGVSYAHIL QAVLKVPGNEARLKAFSTCGSHVCVILVFYIPGMFSFLTHRFGHHVPHHVHVLLAILYRL VPPALNPLVYRVKTQKIHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat SLC35E1 Protein, His (Fc)-Avi-tagged
SLC35E1-5175R 50 µg

Recombinant Rat SLC35E1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Rat Kcnmb2 Pre-designed siRNA Set A
SI207120A 1 Each

Rat Kcnmb2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Mycoplasma Capricolum coaD Protein (aa 1-140)
VAng-Lsx06173-50gEcoli 50 µg (E. coli)

Recombinant Mycoplasma Capricolum coaD Protein (aa 1-140)

Sign In for Pricing
View Details
Sheep Zinc Finger Protein 33B (ZNF33B) ELISA Kit
MBS9924889-01 48 Well

Sheep Zinc Finger Protein 33B (ZNF33B) ELISA Kit

Sign In for Pricing
View Details
Sheep Zinc Finger Protein 33B (ZNF33B) ELISA Kit
MBS9924889-02 96 Well

Sheep Zinc Finger Protein 33B (ZNF33B) ELISA Kit

Sign In for Pricing
View Details
Sheep Zinc Finger Protein 33B (ZNF33B) ELISA Kit
MBS9924889-03 5x 96 Well

Sheep Zinc Finger Protein 33B (ZNF33B) ELISA Kit

Sign In for Pricing
View Details