Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 52L2 (OR52L2P)

This Recombinant Human Putative olfactory receptor 52L2 (OR52L2P) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Putative olfactory receptor 52L2, Olfactory receptor OR11-74

UniProt

Q8NGH6

Expression Region

1-319

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLDSFFSFLLKSLIMALSNSSWRLPQPSFFLVGIPGLEESQHWIALPLGILYLLALVGN VTILFIIWMDPSLHQSMYLFLSMLAAIDLVVASSTAPKALAVLLVRAQEIGYTVCLIQMF FTHAFSSMESGVLVAMALDRYVAICHPLHHSTILHPGVIGHIGMVVLVRGLLLLIPFLIL LRKLIFCQATIIGHAYCEHMAVVKLACSETTVNRAYGLTVALLVVGLDVLAIGVSYAHIL QAVLKVPGNEARLKAFSTCGSHVCVILVFYIPGMFSFLTHRFGHHVPHHVHVLLAILYRL VPPALNPLVYRVKTQKIHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrpl15 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4588602 1.0 µg DNA

Mrpl15 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Candida Albicans OBPALPHA Protein (aa 1-429)
VAng-Lsx05777-50gEcoli 50 µg (E. coli)

Recombinant Candida Albicans OBPALPHA Protein (aa 1-429)

Sign In for Pricing
View Details
Yeast Extract Bioprocess Grade
1721 500 g

Yeast Extract Bioprocess Grade

Sign In for Pricing
View Details
SYVN1 Blocking Peptide
33R-1484 100 ug

SYVN1 Blocking Peptide

Sign In for Pricing
View Details
Thra (NM_031134) Rat Tagged Lenti ORF Clone
RR200270L3 10 µg

Thra (NM_031134) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Anti-Human IgG Fc FITC
L35085 1 mL

Rabbit Anti-Human IgG Fc FITC

Sign In for Pricing
View Details