Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1038 (Olfr1038)

This Recombinant Mouse Olfactory receptor 1038 (Olfr1038) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Olfactory receptor 1038, Olfactory receptor 185-3

UniProt

Q8VGS1

Expression Region

1-319

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEVNISYVSEFILKGITDRPELQAPCFVMFLTIYLVTVLGNLGLIVIIRVDSRLHTPMY FFLSHLAFVDLCYSSAITPKMMVNFVVERNTIPFHACATQLGCFLTFMITECFLLASMAY DRYVAICSPLHYSTLMSKRVCIQLVAVPYVYSFLVALFHTIITFRLTYCGPNVINHFYCD DLPLLALSCSDTHMKEILIFAFAGFDMICSSSIVLTSYLFIIAAILRIRSTQGRRKAIST CGSHMVAVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPLIYSLRNKEVKDA SKKALDKGYETLKILRLSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4423-5p inhibitor
HY-RI01022-01 5 nmol

Hsa-miR-4423-5p inhibitor

Sign In for Pricing
View Details
Hsa-miR-4423-5p inhibitor
HY-RI01022-02 20 nmol

Hsa-miR-4423-5p inhibitor

Sign In for Pricing
View Details
TCEAL6 Rabbit Polyclonal Antibody
APRab00636-01 20 µL

TCEAL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TCEAL6 Rabbit Polyclonal Antibody
APRab00636-02 50 µL

TCEAL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TCEAL6 Rabbit Polyclonal Antibody
APRab00636-03 100 µL

TCEAL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TCEAL6 Rabbit Polyclonal Antibody
APRab00636-04 200 µL

TCEAL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details