Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1444 (Olfr1444)

This Recombinant Mouse Olfactory receptor 1444 (Olfr1444) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Olfactory receptor 1444, Olfactory receptor 202-4

UniProt

Q8VFX2

Expression Region

1-319

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSMENITEVTEFILLGLTDDPNLQVPLLLIFLFIYLVTLIGNGGMMVIIFSDSHLHTPM YFFLSNLSFVDLGYSSAVAPKMVAALQSGNKVISYNGCAAQFFFFVGFATVECYLLASMA YDRHAAVCRPLHYTTTMTTGVCTILTIGSYTCGFLNASIHAADTFKLSFCGSNKINHFFC DIPPLLALACSSTHISKLVVFFVVGFNVFFTLLVIIISYFFIYIAIQNMKSSEGRKKAFS TCASHLTAVSIFYGTIIFMYLQPSSGQSMDTDKIASVFYTVVIPMLNPLIYSLRNREVKS ALWKILNRFYPASFSVSRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Secretory Component / ECM1 (ECM1/2889R), CF647 conjugate, 0.1mg/mL
BNC472889-500 1x 500 µL

Secretory Component / ECM1 (ECM1/2889R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
High Sensitivity Human IL-6 (Interleukin 6) ELISA Kit
E-HSEL-H0003-01 24 Tests

High Sensitivity Human IL-6 (Interleukin 6) ELISA Kit

Sign In for Pricing
View Details
High Sensitivity Human IL-6 (Interleukin 6) ELISA Kit
E-HSEL-H0003-02 48 Tests

High Sensitivity Human IL-6 (Interleukin 6) ELISA Kit

Sign In for Pricing
View Details
High Sensitivity Human IL-6 (Interleukin 6) ELISA Kit
E-HSEL-H0003-03 96 Tests

High Sensitivity Human IL-6 (Interleukin 6) ELISA Kit

Sign In for Pricing
View Details
IL-4 (Interleukin-4), Mouse (11B11), CF594 conjugate, 0.1mg/mL
BNC942008-100 1x 100 µL

IL-4 (Interleukin-4), Mouse (11B11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772D-01 20 Tests

PE Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details