Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1444 (Olfr1444)

This Recombinant Mouse Olfactory receptor 1444 (Olfr1444) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Olfactory receptor 1444, Olfactory receptor 202-4

UniProt

Q8VFX2

Expression Region

1-319

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSMENITEVTEFILLGLTDDPNLQVPLLLIFLFIYLVTLIGNGGMMVIIFSDSHLHTPM YFFLSNLSFVDLGYSSAVAPKMVAALQSGNKVISYNGCAAQFFFFVGFATVECYLLASMA YDRHAAVCRPLHYTTTMTTGVCTILTIGSYTCGFLNASIHAADTFKLSFCGSNKINHFFC DIPPLLALACSSTHISKLVVFFVVGFNVFFTLLVIIISYFFIYIAIQNMKSSEGRKKAFS TCASHLTAVSIFYGTIIFMYLQPSSGQSMDTDKIASVFYTVVIPMLNPLIYSLRNREVKS ALWKILNRFYPASFSVSRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS710213 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Recombinant Human Proenkephalin-B/PDYN Protein (His Tag)
PKSH033558-01 10 µg

Recombinant Human Proenkephalin-B/PDYN Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Proenkephalin-B/PDYN Protein (His Tag)
PKSH033558-02 50 µg

Recombinant Human Proenkephalin-B/PDYN Protein (His Tag)

Sign In for Pricing
View Details
CD15 / FUT4 (Reed-Sternberg Cell Marker) (FUT4/1478R), 1mg/mL
BNUM1478-50 1x 50 µL

CD15 / FUT4 (Reed-Sternberg Cell Marker) (FUT4/1478R), 1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG1 HP6091,  10nm
GM-201-10 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG1 HP6091, 10nm

Sign In for Pricing
View Details
FAM177B (NM_207468) Human Recombinant Protein
TP312603 20 µg

FAM177B (NM_207468) Human Recombinant Protein

Sign In for Pricing
View Details