Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 56B4 (OR56B4)

This Recombinant Human Olfactory receptor 56B4 (OR56B4) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Olfactory receptor 56B4, Olfactory receptor OR11-67

UniProt

Q8NH76

Expression Region

1-319

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTSTSVTYDSSLQISQFILMGLPGIHEWQHWLSLPLTLLYLLALGANLLIIITIQHETV LHEPMYHLLGILAVVDIGLATTIMPKILAIFWFDAKAISLPMCFAQIYAIHCFFCIESGI FLCMAVDRYIAICRPLQYPSIVTKAFVFKATGFIMLRNGLLTIPVPILAAQRHYCSRNEI EHCLCSNLGVISLACDDITVNKFYQLMLAWVLVGSDMALVFSSYAVILHSVLRLNSAEAM SKALSTCSSHLILILFHTGIIVLSVTHLAEKKIPLIPVFLNVLHNVIPPALNPLACALRM HKLRLGFQRLLGLGQDVSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDXK Rabbit Polyclonal Antibody
TA379783 100 µL

PDXK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NTAQ1 (NM_001283027) Human Tagged ORF Clone
RG235953 10 µg

NTAQ1 (NM_001283027) Human Tagged ORF Clone

Sign In for Pricing
View Details
IGF2BP2 (NM_001007225) Human Over-expression Lysate
LC423450 20 µg

IGF2BP2 (NM_001007225) Human Over-expression Lysate

Sign In for Pricing
View Details
IL21R Antibody
OC-681-01 50 μL

IL21R Antibody

Sign In for Pricing
View Details
IL21R Antibody
OC-681-02 100 µL

IL21R Antibody

Sign In for Pricing
View Details
IL21R Antibody
OC-681-03 1 mL

IL21R Antibody

Sign In for Pricing
View Details