Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8K1 (OR8K1)

This Recombinant Human Olfactory receptor 8K1 (OR8K1) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Olfactory receptor 8K1, Olfactory receptor OR11-182

UniProt

Q8NGG5

Expression Region

1-319

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHVVKHNHTAVTKVTEFILMGITDNPGLQAPLFGLFLIIYLVTVIGNLGMVILTYLDSK LHTPMYFFLRHLSITDLGYSTVIAPKMLVNFIVHKNTISYNWYATQLAFFEIFIISELFI LSAMAYDRYVAICKPLLYVIIMAEKVLWVLVIVPYLYSTFVSLFLTIKLFKLSFCGSNII SYFYCDCIPLMSILCSDTNELELIILIFSGCNLLFSLSIVLISYMFILVAILRMNSRKGR YKAFSTCSSHLTVVIMFYGTLLFIYLQPKSSHTLAIDKMASVFYTLLIPMLNPLIYSLRN KEVKDALKRTLTNRFKIPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GDA Antibody Picoband® Fluoro647 Conjugated
A01619-1-Fluoro647 100 µg/Vial

Anti-GDA Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse BTNL2/BTL-II Protein, C-His
AP93297 50 µg

Recombinant Mouse BTNL2/BTL-II Protein, C-His

Sign In for Pricing
View Details
Galectin 3 (LGALS3) Mouse Monoclonal Antibody [Clone ID: OTI1A4]
TA506398S 30 µL

Galectin 3 (LGALS3) Mouse Monoclonal Antibody [Clone ID: OTI1A4]

Sign In for Pricing
View Details
Human TPH1 Protein Lysate
MBS8429003-01 0.02 mg

Human TPH1 Protein Lysate

Sign In for Pricing
View Details
Human TPH1 Protein Lysate
MBS8429003-02 5x 0.02 mg

Human TPH1 Protein Lysate

Sign In for Pricing
View Details
NIRF (UHRF2) (NM_152896) Human Over-expression Lysate
LH14745V 100 µg

NIRF (UHRF2) (NM_152896) Human Over-expression Lysate

Sign In for Pricing
View Details